hem > Produkter > Potentiometrisk titrator > Spåra fuktanalysator > Manuell högprecisionsfuktanalysator

Produkter

Manuell högprecisionsfuktanalysator
  • Manuell högprecisionsfuktanalysatorManuell högprecisionsfuktanalysator

Manuell högprecisionsfuktanalysator

Manuell högprecisions fuktanalysator är en ekonomisk Coulometric Karl Fischer fuktanalysator som lanserades av vårt företag. Instrumentet använder Karl Fischer -principen för att bestämma provets fukthalt genom att reagera det elektrolytiska reagenset med fuktigheten i provet.

modell:JH-C5

skicka förfrågan    PDF nedladdning

produkt beskrivning

Manuell högprecisionsfuktanalysator

The JH-C5 Manuell högprecisionsfuktanalysator is an economical Coulometric Karl Fischer moisture analyzer launched by our company. The instrument uses the Karl Fischer principle to determine the moisture content of the sample by reacting the electrolytic reagent with the moisture in the sample.

 

1. Manuell högprecisionsfuktanalysator  Introduction


Manuell högprecisionsfuktanalysator can quickly determine the properties of alcohols, oils, lipids, ethers, esters, acids, alkanes, benzenes, amines, organic solvents, pesticides, phenols, pharmaceutical raw materials, etc. The moisture content in different solids, liquids, and gases. It has the advantages of high measurement accuracy, fast speed, stable and reliable measurement data, applicable standards: GB/T1600; GB7600; B/T 18619,1; GB/T 11133; SH/T 0246; SH/T 0255- och andra metodstandarder.

 

2. Manuell högprecisionsfuktanalysator  Parameter


Modell

JH-C5

Mätområde

3ug ~ 199mg (H2O), 1ppm ~ 100%

Läsenhet

ug vatten

Detekteringsnoggrannhet

0,1 ug (H2O)

Noggrannhet

99,7% (1000 ug rent vatten)

Strömområde för elektrolys

0-400mA

temperaturvariation

0-299â „ƒ

Slutfördröjning

anpassningsbar

Elektrolyshastighet

Enligt reagensets elektrolyskapacitet, välj 6 växlar, automatisk styrning

Drivhantering

Intelligent spårning, automatisk bearbetning

Beräkningsformel

6 formler för att anpassa till olika beräkningsbehov

Driftgränssnitt

Peka på färgskärmen

Datalagring

200 grupp

Kalibreringsfunktion

JA

Skrivare

Pr-1 dedikerad dataskrivare

Strömförsörjning

220V / 50Hz

Kraft

35W

Omgivningstemperatur

5-40â „ƒ

Miljöfuktighet

20 ~ 80%

Mått

320*280*160 mm

Nettovikt

5,0 kg

 

3. Manuell högprecisionsfuktanalysator Feature And Application


1. Pekdrift, LED fullfärgs LCD-display, realtidsvisning av titreringskurva;

2. Helautomatisk konstantströmspolarisationsdetektering, inget behov av att manuellt ställa in slutpunkten, hög detekteringsnoggrannhet;

3.6-hastighetsmätningshastigheten kan justeras, lämplig för reagenser med olika styrkor;

4. Innehåller beräkningsformler för att tillgodose behoven hos olika applikationer såsom fasta ämnen, vätskor och gaser;

5. Testresultaten beräknas automatiskt och sparas automatiskt;

6. Med datakalibreringsfunktion är den lämplig för provdetektering i olika områden av vatteninnehåll;

7. Intelligent spårningsvärde, automatiskt bakgrundsavdrivningsavdrag, noggrann bestämning av provets sanna fukthalt;

8. Slutpunktsfördröjningsfunktion, lämplig för speciell provdetektering;

9. Stöd myndighetshantering, revisionsspår, följ GLP/GMP -bestämmelserna;

10. Flera datagränssnitt (RS-2232C, USB, WEB-gränssnitt).


4. Fields of use Manuell högprecisionsfuktanalysator


Manuell högprecisionsfuktanalysator is a general-purpose laboratory equipment and is widely used. It can be used in food, drug inspection, disease control, commodity inspection, water treatment, petroleum, chemical, marine, electric power, environmental protection, new energy, teaching, scientific research, etc. Related areas.

 

5. Produktkvalificering


JiahangManuell högprecisionsfuktanalysator  has obtained CE certification, TART certification, ISO quality management system certification, more than 10 software copyrights and multiple patents to ensure that each instrument has stable performance and excellent quality.

 

6. Leverera, leverera och servera


Vi har ett topp FoU-team som återvänder från Europa och Amerika, samarbetar med vårt fantastiska tillverkningsteam, professionella säljteam och dedikerade serviceteam, som arbetar tillsammans för att ge kunderna högteknologiska, högkvalitativa produkter och effektiva, bekväma och omfattande förförsäljningar och professionella tjänster efter försäljning.


7. Vanliga frågor


F:How many years have your company made Manuell högprecisionsfuktanalysator?     

A: 22 års tillverkare av vetenskapliga instrument, leverantör av laboratorielösningar!

F:Vilket certifikat har du för dina produkter?

A:Jiahang har erhållit CE -certifiering, TART -certifiering, ISO -kvalitetsstyrningssystemcertifiering, mer än 10 programvaror och flera patent för att säkerställa att varje instrument har stabil prestanda och utmärkt kvalitet.

F:Kommer du att delta på mässan för att visa dina produkter?

A:Yes,Varje år kommer vi att delta i några internationellt kända utställningar för att lansera våra nya produkter, såsom Arablabã € PICCTONã € Analytica Russiaã € Lab Africaã € Analytica Germanyã € Analytica Latin America och så vidare, vi ser fram emot ditt besök.

F:Vad sägs om ditt företags FoU -styrka

A:Besitter starka FoU-tekniska förmågor (ett FoU-team på mer än 20 personer, med en genomsnittlig doktorsexamen, examen från välkända universitet hemma och utomlands, med en genomsnittlig arbetslivserfarenhet på 8 år), som kan hantera och lösa produktrelaterade tekniska problem

F:Om OEM är acceptabelt?

A:Ge OEM-anpassningstjänst, produktens inbyggda programvara har autonomi, kan anpassa utvecklingsinställningar

F:Är du ett handelsföretag eller en tillverkare?

A:100% tillverkare, inga mellanhänder och distributörer gör prisskillnaden, priset på källfabriken är mycket fördelaktigt; Jiahang har sitt huvudkontor i Shanghai, Kina, har 15 servicestationer och 2 produktionsanläggningar i Kina och har försäljning i mer än 10 länder utomlands.

F:Vad sägs om din leveranstid?

A:"Generellt kommer det att ta 7 till 15 arbetsdagar efter att du fått din förskottsbetalning. Beror på kvantiteten."

F:Vilken betalning kan accepteras?

A:Vi kan acceptera betalningen med L/C, TF, Paypal, Western Union, etc.

F:Service

A:Vi kan tillhandahålla online -instruktion; Realtidsstöd via video-ca eller röstchatt.

A:Varje kund som samarbetar för första gången lovar att erbjuda en provkostnad för produktionskostnadspris för att lösa dina bekymmer om produktkvalitetsproblem.

A:Ge officiella produktkvalitetssäkringsdokument som överensstämmer med juridiska fördelar för att eskortera dig med bekymmersfri kundservice.

 

 

 

 

Heta etiketter: Manuell högprecisionsfuktanalysator, Kina, fabrik, billig, avancerad, tillverkare, leverantörer, pris, CE

relaterade kategori

skicka förfrågan

Vänligen gärna ge din förfrågan i formuläret nedan. Vi kommer att svara dig om 24 timmar.