hem > Produkter > Potentiometrisk titrator > Fuktanalysator > Hög precision Fuktanalysator

Produkter

Hög precision Fuktanalysator
  • Hög precision FuktanalysatorHög precision Fuktanalysator
  • Hög precision FuktanalysatorHög precision Fuktanalysator

Hög precision Fuktanalysator

Hög precision Moisture Analyzer är en helautomatisk volymetrisk Karl Fischer Moisture Analyzer med oberoende immateriella rättigheter som designats och utvecklats av företaget. Instrumentet använder den volymetriska titreringsmetoden med Karl Fischer -reagens som standardlösning som analysprincip, kombinerat med den senaste mekaniska och elektroniska designtekniken och humaniserad gränssnittsdesign, med god lufttäthet, lågt driftvärde och detektionsgräns, brett mätområde och hög grad av automatisering, hög precision, kan användas för att exakt analysera kristallvatten, adsorberat vatten och fritt vatten i fasta, flytande och gasprover.

modell:JH-V5

skicka förfrågan    PDF nedladdning

produkt beskrivning

Hög precision Fuktanalysator


Hög precision Fuktanalysator is a fully automatic volumetric Karl Fischer Moisture Analyzer with independent intellectual property rights designed and developed by the company. The instrument uses the volumetric titration method with Karl Fischer reagent as the standard solution as the analysis principle, combined with the latest mechanical and electronic design technology and humanized interface design, with good airtightness, low drift value and detection limit, wide measurement range, and high degree of automation , High precision, can be used to accurately analyze crystal water, adsorbed water, and free water in solid, liquid, and gas samples.


1. Hög precision Fuktanalysator  Introduction


Product name: Hög precision Fuktanalysator

Mätområde för fuktinnehåll: 0,001%~ 100%(10 ppm ~ 100%)

Titreringskontrollnoggrannhet: 0,2μl

Titreringsfunktion: PID styr automatiskt titreringshastigheten, driften uppdateras automatiskt och dras av automatiskt; slutpunkten bibehålls automatiskt;

Hjälpfunktioner: automatisk rengöringsfunktion, utrustningsverifieringsfunktion, waste vätskeflaska full varningsfunktion, automatisk datakalkyl, resultatstatistikfunktion;

Fördröjningsinställning: Fördröjningstitrering och slutpunktsfördröjningsfunktion kan ställas in efter behov för att hantera olösliga prover;

Titreringsrepetabilitet (RSD): 99,7% (2 ml reagens)

Mättid: 3 minuter i genomsnitt;

Databehandling: beräkna automatiskt analysresultaten, visa förbrukning av reagenser, vattenkvalitet, procentandel, ppm, etc.;

Datalagring: 12 grupper;

Mätresultat: 20 grupper;

Inbyggd skrivare

Ventil- och rörledningsmaterial: trevägs tvåvägs elektromagnetisk drivreglerventil, korrosionsskyddande rörledning och tätningsfog;

Extern elektrod: dubbel platinaelektrod;

Operationsgränssnitt: LCD -display, navigeringsmeny (kinesisk version);

Använd miljöfuktighet: 80%

Strömförsörjning: 110 ~ 220V (AC), 50 ~ 60Hz

Storlek: 580 × 460 × 360 mm

Vikt: 9,6 kg

 

2. Hög precision Fuktanalysator  Parameter


Modell

JH-V5

Mätområde för fuktinnehåll

0,001%-100 (10 sid / min-100%)

Titreringskontrollnoggrannhet

0,2 uL

Titreringsfunktion

PID automatisk kontroll titreringshastighet, drift automatisk uppdatering automatiskt avdrag; Automatisk hållare

Tillgänglighet

Automatisk rengöringsfunktion, utrustningsverifieringsfunktion, fullständig varningsfunktion för spillvätska, automatisk beräkning av data, resultatstatistikfunktion

Fördröjningsinställning

Fördröjningstitrering och terminalfördröjning kan ställas in efter behovet av att hantera olösliga prover

Titreringsrepetabilitet (RSD)

RSDâ ‰ ¥ 99,7%ï¼ ›(2 ml reagens)

mäta tid

3 minuter i genomsnitt

databehandling

Resultat av automatisk beräkningsanalys, visar förbrukningstestdos, vattenkvalitet, procentuellt innehåll, PPM, etc.

datalagring

12 grupper

Mätresultaten

20 grupper

Inbyggd skrivare

JA

Ventil- och rörmaterial

Trevägs tvåvägs magnetventilstyrventil, korrosionsskyddande materialrörledning och tätningsfog

Extern elektrod

Dubbel platinaelektrod

operation gränssnitt

LCD -skärm, navigeringsmeny

Använd miljöfuktighet

- 80%

strömförsörjning

110 ~ 220V (AC) / 50-60Hz

Storlek

580*460*360 mm

Vikt

9,6 kg

 

 

3. Hög precision Fuktanalysator Feature And Application

 

Pekdrift, grafiskt gränssnitt, LED-färgskärm i fullfärg, flytande kristall, realtidsvisning av titreringskurva, doseringspumpens injektionsvolym, detektionstid, förbrukningsreagensvolym, aktuell vattenvolym, driftvolym och andra detektionsparametrar;

Anta en helt sluten titreringscell, systemdriften är extremt låg, lösningsmedlet byts automatiskt ut och spillvätskan släpps ut för att undvika att giftiga reagenser släpps ut och infiltration av miljöfuktighet.

Den har patenterad högprecisionskolv och titreringskontrollteknologi för att säkerställa noggrannheten i systemets mätresultat;

Rörförbandet antar speciella muttrar och tätningar, och en mängd olika flasklock är utformade för att anpassas till en mängd olika reagensflaskor. Olika Karl Fischer -reagens kan användas, och mätresultaten för olika Karl Fischer -reagens går inte att skilja;

Helautomatisk mätning, enkel, snabb och exakt, kan realisera automatisk vätskeutsugning och urladdning, automatisk mätning av drift, automatiskt avdrag för drift, automatisk spårning av miljödrift och automatisk beräkning av resultat (i termer av relativ standardavvikelse);

PID styr automatiskt titreringshastigheten och den genomsnittliga provtesttiden är mindre än 2 minuter;

Stöd myndighetshantering, revisionsspår, följ GLP/GMP -föreskrifter;

Flera datagränssnitt (RS-2232C, USB, WEB-gränssnitt);

Hjälpfunktioner: titreringsfördröjningsfunktion, automatisk slutpunktfördröjningsfunktion, intelligent felbedömningsfunktion, varningsfunktion för överflödig vätskeflaska;

En mängd olika mätresultat enhetsalternativ (ppm, %, ml, mgH2O), valfri dedikerad mikrodataskrivare, uppvärmningsomrörare, kassettvärmningsugn, kassett -headspace -provtagare, halvledarkylanordning, mikrotitreringscell.


4. Fields of use Hög precision Fuktanalysator


Det kan i stor utsträckning tillgodose fuktbestämningsbehoven i många industrier som petroleum, kemikalier, läkemedel, daglig kemikalier, livsmedel, jordbruk och laboratorier.

 

5. Produktkvalificering


JiahangHög precision Fuktanalysator  has obtained CE certification, TART certification, ISO quality management system certification, more than 10 software copyrights and multiple patents to ensure that each instrument has stable performance and excellent quality.

 

6. Leverera, leverera och servera


Vi har ett topp FoU-team som återvänder från Europa och Amerika, samarbetar med vårt fantastiska tillverkningsteam, professionella säljteam och dedikerade serviceteam, som arbetar tillsammans för att ge kunderna högteknologiska, högkvalitativa produkter och effektiva, bekväma och omfattande förförsäljningar och professionella tjänster efter försäljning.


7. Vanliga frågor


F:How many years have your company made Hög precision Fuktanalysator?     

A: 22 års tillverkare av vetenskapliga instrument, leverantör av laboratorielösningar!

F:Vilket certifikat har du för dina produkter?

A:Jiahang har erhållit CE -certifiering, TART -certifiering, ISO -kvalitetsstyrningssystemcertifiering, mer än 10 programvaror och flera patent för att säkerställa att varje instrument har stabil prestanda och utmärkt kvalitet.

F:Kommer du att delta på mässan för att visa dina produkter?

A:Yes,Varje år kommer vi att delta i några internationellt kända utställningar för att lansera våra nya produkter, såsom Arablabã € PICCTONã € Analytica Russiaã € Lab Africaã € Analytica Germanyã € Analytica Latin America och så vidare, vi ser fram emot ditt besök.

F:Vad sägs om ditt företags FoU -styrka

A:Besitter starka FoU-tekniska förmågor (ett FoU-team på mer än 20 personer, med en genomsnittlig doktorsexamen, examen från välkända universitet hemma och utomlands, med en genomsnittlig arbetslivserfarenhet på 8 år), som kan hantera och lösa produktrelaterade tekniska problem

F:Om OEM är acceptabelt?

A:Ge OEM-anpassningstjänst, produktens inbyggda programvara har autonomi, kan anpassa utvecklingsinställningar

F:Är du ett handelsföretag eller en tillverkare?

A:100% tillverkare, inga mellanhänder och distributörer gör prisskillnaden, priset på källfabriken är mycket fördelaktigt; Jiahang har sitt huvudkontor i Shanghai, Kina, har 15 servicestationer och 2 produktionsanläggningar i Kina och har försäljning i mer än 10 länder utomlands.

F:Vad sägs om din leveranstid?

A:"Generellt kommer det att ta 7 till 15 arbetsdagar efter att du fått din förskottsbetalning. Beror på kvantiteten."

F:Vilken betalning kan accepteras?

A:Vi kan acceptera betalningen med L/C, TF, Paypal, Western Union, etc.

F:Service

A:Vi kan tillhandahålla online -instruktion; Realtidsstöd via video-ca eller röstchatt.

A:Varje kund som samarbetar för första gången lovar att erbjuda en provkostnad för produktionskostnadspris för att lösa dina bekymmer om produktkvalitetsproblem.

A:Ge officiella produktkvalitetssäkringsdokument som överensstämmer med juridiska fördelar för att eskortera dig med bekymmersfri kundservice.

 

 

 

 

Heta etiketter: Hög precision Fuktanalysator, Kina, Fabrik, Billig, Avancerad, Tillverkare, Leverantörer, Pris, CE

relaterade kategori

skicka förfrågan

Vänligen gärna ge din förfrågan i formuläret nedan. Vi kommer att svara dig om 24 timmar.

relaterade produkter