hem > Produkter > Refraktometer > Digital automatisk refraktometer > Digital automatisk refraktometer

Produkter

Digital automatisk refraktometer
  • Digital automatisk refraktometerDigital automatisk refraktometer
  • Digital automatisk refraktometerDigital automatisk refraktometer
  • Digital automatisk refraktometerDigital automatisk refraktometer

Digital automatisk refraktometer

DigiPol-R-seriens digitala automatiska refraktometrar är utrustade med högpresterande linjära CCD-ljuskänsliga komponenter, genom höghastighets, högprecisionens signalinsamling och analysbearbetningsteknik, utrustad med halvledar Peltier supertemperaturstyrsystem. Det kan effektivt och noggrant mäta brytningsindex (nD) för olika vätskor som transparent, genomskinlig, mörk, viskös och massfraktionen av sockerlösning (Brix).

modell:DigiPol-R200

skicka förfrågan    PDF nedladdning

produkt beskrivning

Digital automatisk refraktometer

 

DigiPol-R series Digital automatisk refraktometers are equipped with high-performance linear CCD photosensitive components, through high-speed, high-precision signal acquisition and analysis processing technology, equipped with semiconductor Peltier super temperature control system. It can efficiently and accurately measure the refractive index (nD) of various liquids such as transparent, translucent, dark, viscous, and the mass fraction of sugar solution (Brix).

 

1. Produktintroduktion


Innovation:

1: Inbyggd Peltier-temperaturkontroll för att förbättra noggrannhet och stabilitet;

2: LED kall ljuskälla ersätter traditionell natriumlampa och halogen volframlampa;

3: 7-tums pekfärgskärm, humaniserat driftsgränssnitt;

4:Digital automatisk refraktometershas passed TART and CE certification.

 

2. Digital automatisk refraktometer Parameter


Modell

DigiPol-R200

Räckvidd

1.3000-1.7000 (nD)

Upplösning

0,0001 (nD)

Precision

± 0,0002

Brix -sortiment

0-100%(Brix)

Brix noggrannhet

± 0,1%(Brix)

Övningsläge

Brytningsindex / sockerhalt eller anpassat

Temperaturkontrollmetod

Nej

Temperaturreglering

Rumstemperatur

Temperaturkontrollstabilitet

Rumstemperatur

ljuskälla

LED

våglängd

589 nm

Prisma

safir

Provcell

rostfritt stål

Detekteringsmetod

Linjär CCD med hög upplösning

Visningsmetod

7 tum FTF pekskärm i färg

datalagring

32G

Utmatningsmetod

USB, RS232, RJ45, SD -kort, U -disk

Användarhantering

Ja/fyra-nivå myndighetshantering

Verifieringskedja

JA

Elektronisk signatur

JA

Anpassat metodbibliotek

JA

Exportera filen för att verifiera MD5-skydd på hög nivå

JA

WIFI -utskrift

JA

Exportera i flera filformat

PDF och Excel

Storlek

360*300*155 mm

Strömförsörjning

220V / 50Hz

Vikt

5 kg


3. Produktfunktion och applikation


1: Inbyggd Parpaste-temperaturkontroll, förbättra noggrannhet och stabilitet;

2: Kinas första dubbla temperaturkontroll, safirprisma;

3: LED kall ljuskälla istället för den traditionella natriumljuslampan och halogen volframlampa;

4: Överensstämmelse med 21CFR del 1 revisionsspår, farmakopé och elektronisk signatur;

5: Stöd för nätverksutskrift, stöd för statistisk hämtning av data;

6: Myndighetshantering på flera nivåer, myndighet kan konfigureras fritt;

7 "pekfärgskärm, användarvänligt driftsgränssnitt;

8: Digital automatisk refraktometershas passed TART and CE certification.

 

4. Användningsområden


Digital automatisk refraktometersis widely used in petroleum industry, oil industry, pharmaceutical industry, food industry, daily chemical industry, sugar industry, etc. It is also one of the commonly used equipment in schools and related scientific research units.

Livsmedelsindustrin: kvalitetskontroll av råvaror, mellanprodukter och slutprodukter; Koncentrationen av torrsubstans, fasta ämnen och sockerarter; Renhetskontroll för produkter från socker, dessert, dryck, mejeri, choklad och kaffe, olja och fettindustri.

Läkemedelsindustrin: bestämning av fast innehåll i blod och urin; Renhetskontroll.

Kosmetikindustrin: bestämning av brytningsindex för eteriska oljor och kryddor; Bestäm fettsyrainnehållet i tvål och doftingredienser.

Kemisk och petrokemisk industri: bestämning av brytningsindex för råvaror och analytiska reagens; Renhetskontroll; Bestämning av brytningsindex för petroleumprodukter; Bestäm koncentrationen av den kylda smörjoljan.

 

5.Produktinformation


Through high-speed and high precision signal acquisition, analysis and processing technology, the Digipol-R Digital automatisk refraktometersis equipped with a semiconductor Parte super temperature control system. It can measure the refractive index (Nd) and the mass fraction of sugar solution (Brix) of transparent, translucent, dark and viscous liquid with high accuracy and efficiency.

 

6. Produktkvalificering


JiahangDigital automatisk refraktometerhas obtained CE certification, TART certification, ISO quality management system certification, more than 10 software copyrights and multiple patents to ensure that each instrument has stable performance and excellent quality.

 

7. Leverera, leverera och servera


Vi har ett topp FoU-team som återvänder från Europa och Amerika, samarbetar med vårt fantastiska tillverkningsteam, professionella säljteam och dedikerade serviceteam, som arbetar tillsammans för att ge kunderna högteknologiska, högkvalitativa produkter och effektiva, bekväma och omfattande förförsäljningar och professionella tjänster efter försäljning.



8. Vanliga frågor


F:How many years have your company made Digital automatisk refraktometer?     

A: 22 års tillverkare av vetenskapliga instrument, leverantör av laboratorielösningar!

F:Vilket certifikat har du för dina produkter?

A:Jiahang har erhållit CE -certifiering, TART -certifiering, ISO -kvalitetsstyrningssystemcertifiering, mer än 10 programvaror och flera patent för att säkerställa att varje instrument har stabil prestanda och utmärkt kvalitet.

F:Kommer du att delta på mässan för att visa dina produkter?

A:Yes,Varje år kommer vi att delta i några internationellt kända utställningar för att lansera våra nya produkter, såsom Arablabã € PICCTONã € Analytica Russiaã € Lab Africaã € Analytica Germanyã € Analytica Latin America och så vidare, vi ser fram emot ditt besök.

F:Vad sägs om ditt företags FoU -styrka

A:Besitter starka FoU-tekniska förmågor (ett FoU-team på mer än 20 personer, med en genomsnittlig doktorsexamen, examen från välkända universitet hemma och utomlands, med en genomsnittlig arbetslivserfarenhet på 8 år), som kan hantera och lösa produktrelaterade tekniska problem

F:Om OEM är acceptabelt?

A:Ge OEM-anpassningstjänst, produktens inbyggda programvara har autonomi, kan anpassa utvecklingsinställningar

F:Är du ett handelsföretag eller en tillverkare?

A:100% tillverkare, inga mellanhänder och distributörer gör prisskillnaden, priset på källfabriken är mycket fördelaktigt; Jiahang har sitt huvudkontor i Shanghai, Kina, har 15 servicestationer och 2 produktionsanläggningar i Kina och har försäljning i mer än 10 länder utomlands.

F:Vad sägs om din leveranstid?

A:"Generellt kommer det att ta 7 till 15 arbetsdagar efter att du fått din förskottsbetalning. Beror på kvantiteten."

F:Vilken betalning kan accepteras?

A:Vi kan acceptera betalningen med L/C, TF, Paypal, Western Union, etc.

F:Service

A:Vi kan tillhandahålla online -instruktion; Realtidsstöd via video-ca eller röstchatt.

A:Varje kund som samarbetar för första gången lovar att erbjuda en provkostnad för produktionskostnadspris för att lösa dina bekymmer om produktkvalitetsproblem.

A:Ge officiella produktkvalitetssäkringsdokument som överensstämmer med juridiska fördelar för att eskortera dig med bekymmersfri kundservice.


Heta etiketter: Digital automatisk refraktometer, Kina, fabrik, billig, avancerad, tillverkare, leverantörer, pris, CE

relaterade kategori

skicka förfrågan

Vänligen gärna ge din förfrågan i formuläret nedan. Vi kommer att svara dig om 24 timmar.